PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02586.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 440aa    MW: 49403.7 Da    PI: 8.1521
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02586.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.34.5e-51141421128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lp+G+rF+Ptdeelv++yL++k++g++ ++ ++i+e+di+k+ePwdLp  +++k++++ew fF++ d+k+++g+r+nr+t +g Wk
  Rsa1.0_02586.1_g00002.1  14 LPVGLRFRPTDEELVSYYLRRKIKGHDDDV-KAIREIDICKCEPWDLPdfSAIKTKDSEWLFFCPLDRKHPNGSRQNRSTLAGHWK 98 
                              799************************999.89**************96448899999**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++++s k++++g+k+tLvf++grapkg++t+Wvmheyr+
  Rsa1.0_02586.1_g00002.1  99 ATGKDRKIKSGKNKVIGVKRTLVFHSGRAPKGTRTNWVMHEYRA 142
                              **********99******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-5611165IPR003441NAC domain
PROSITE profilePS5100554.57914165IPR003441NAC domain
PfamPF023657.3E-2515141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009814Biological Processdefense response, incompatible interaction
GO:0010200Biological Processresponse to chitin
GO:0070417Biological Processcellular response to cold
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MNQNSIKELT VDSLPVGLRF RPTDEELVSY YLRRKIKGHD DDVKAIREID ICKCEPWDLP  60
DFSAIKTKDS EWLFFCPLDR KHPNGSRQNR STLAGHWKAT GKDRKIKSGK NKVIGVKRTL  120
VFHSGRAPKG TRTNWVMHEY RATEHDLCGT NPGQSPFVIC KLFKKQDPSL VEEEAVSSPT  180
SSLDKTKSEV SMVAVKPESS LVISGDSRNG GACNVATTSK LGDLDWLSFP ELESMTVFSP  240
LHSQVQSEFG SSFNAFLQPS SSDFSGNHNN NNFQIQTQYG TNDEEDTDVS RFLNSVLDFQ  300
DDQDFVFPCE FDGAVPDQIA PAYQQQRSSG DMSDDVSRTG IKLQPRREQP SGFTTDYVIH  360
GNASRRLRLQ TIKREVEDTD GEAIKKGKLM RSKSRTRFLF KKIMPVRCSY GGLLRAAVVA  420
VLFLISVCSL TTDFRASLMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-46916615169NAC domain-containing protein 19
3swp_C2e-46916615169NAC domain-containing protein 19
3swp_B2e-46916615169NAC domain-containing protein 19
3swp_A2e-46916615169NAC domain-containing protein 19
3swm_D2e-46916615169NAC domain-containing protein 19
3swm_C2e-46916615169NAC domain-containing protein 19
3swm_B2e-46916615169NAC domain-containing protein 19
3swm_A2e-46916615169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00398DAPTransfer from AT3G49530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP6413550.0KP641355.1 Brassica napus NAC transcription factor 62-3.1 (NAC62-3.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009150140.10.0PREDICTED: NAC transcription factor 29-like
SwissprotQ9SCK60.0NAC62_ARATH; NAC domain-containing protein 62
TrEMBLA0A109P4Q30.0A0A109P4Q3_BRANA; NAC transcription factor 62-2.1
STRINGBra019599.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24162873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49530.10.0NAC domain containing protein 62